PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 254aa    MW: 28960.9 Da    PI: 8.7209
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593773.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-153582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eE e+l+  + + G ++W++I++  g+ R++k+c++rw +yl
   XP_013593773.1 35 RGPWSDEESEILKAFILKNGHRNWRSIPKLAGLMRCGKSCRLRWVNYL 82
                     89********************************************97 PP

2Myb_DNA-binding48.81.6e-1588132148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++++ lG++ W++Ia+++g  Rt++++k+ w+++l
   XP_013593773.1  88 RGNFTKEEEDTIIHLHQTLGNK-WAKIASHLG--RTDNEIKNVWNTHL 132
                      89********************.********8..***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0543082IPR017930Myb domain
SMARTSM007173.5E-113484IPR001005SANT/Myb domain
SuperFamilySSF466892.1E-2534128IPR009057Homeodomain-like
PfamPF002491.2E-133582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-213689IPR009057Homeodomain-like
CDDcd001671.57E-83782No hitNo description
PROSITE profilePS5129423.4883136IPR017930Myb domain
SMARTSM007174.3E-1487134IPR001005SANT/Myb domain
PfamPF002492.0E-1488132IPR001005SANT/Myb domain
CDDcd001672.19E-890132No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2590137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MNISYQILQK LKSVFVSVMG KGKAPCCDHS QILKRGPWSD EESEILKAFI LKNGHRNWRS  60
IPKLAGLMRC GKSCRLRWVN YLRPGLKRGN FTKEEEDTII HLHQTLGNKW AKIASHLGRT  120
DNEIKNVWNT HLKKRLIKRN SSASSDVTNQ APSVSRSSSS SSSSVSNNVI KSEKLNQEEE  180
LEQILVEDMA SGFEVNAPQS LESLFEDRKV PPPITKPDSL EIRGKSDDEL CRQMVEPGLD  240
DYNEWLIYFD NQTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21331365108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00352DAPTransfer from AT3G12820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593773.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D3AE581e-176A0A0D3AE58_BRAOL; Uncharacterized protein
STRINGBra039344.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140961624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12820.11e-116myb domain protein 10